شناسایی، توالی‌یابی و تعیین پروتئین استنباطی ژن هم‌ساخت APETALA1 (AP1) درخردل سیاه (Brassica nigra)

نوع مقاله: مقاله پژوهشی

چکیده

گذر به ‌گل‌دهی یک تغییر فاز بزرگ در چرخه‌ی زندگی گیاهان است. ژن APETALA1 در پیش‌برد مرحله‌ گذر ونیز تعیین هویت مریستم گل نقش ایفا می‌کند. این پژوهش با هدف طراحی پرایمر، استخراج، شناسایی و تعیین توالی این ژن در گیاه خردل سیاه (Brassica nigra)انجام شد. RNA کل از گل‌های بالغ استخراج و برای ساخت cDNA استفاده گردید. آغازگرهای اختصاصی بر اساس توالی ژن‌های هم‌ساخت AP1 در گیاهان هم خانواده در سایت NCBI طراحی و در واکنش RT-PCR استفاده گردید. محصول این واکنش پس از خالص سازی تعیین توالی‌ شد. نتایج نشان دهنده‌ی تکثیر قطعه‌ی مورد نظر از ژن به طول 618 نوکلئوتید بود که BniAP1 نام‌گذاری شد و در پایگاه NCBI ثبت گردید. مقایسه‌ی توالی پروتئین استنباطی BniAP1 با سایر هم‌ساخت‌های AP1 نشان دهنده‌ی شباهت بین 60 تا 91 درصدی این توالی با توالی‌های مشابه بود و این قطعه دارای 206 آمینواسید است. مطابق با این نتایج می‌توان پیشنهاد داد که BniAP1 نیز به عنوان هومولوگ AP1 در گذر به گل‌دهی نقش دارد و می‌تواند به عنوان ژن تعیین هویت مریستم گل عمل کند.

کلیدواژه‌ها


عنوان مقاله [English]

Identification, sequencing and determination of deduce protein APETALA1 (AP1) homologous gene in Brassica nigra

چکیده [English]

The transition to flowering is an important step of plant life cycle. APETALA1 geneplays a role in promoting the floral transition and also determining flower meristem identity. This study aimed to conduct primers design, extraction, identification and sequencing of this gene in Brassica nigra. Total RNA was isolated from mature flowers of Brassica nigra and used for first-strand cDNA synthesis. The specific primers were designed based on nucleotide sequence alignment of AP1 homologus genes from other plants and used in RT-PCR. The RT-PCR product were purified and sequenced. The results indicated amplification of 618 nucleotides fragment that named BniAP1 and record in NCBI database. Deduce protein obtained from sequenced fragment of AP1 consists of 206 amino acids. Comparison of the deduce protein sequence with AP1 homologous proteins from other species showed 60% to 91% identity. According to these results, BniAP1 may play a similar role as AP1 in transition to floweringand could act as a flower meristem identity gene in Brassica nigra.

کلیدواژه‌ها [English]

  • APETALA1 gene
  • Brassica nigra
  • Flowering
  • RT-PCR

درچرخه‌ی زندگی نهان‌دانگان گذر از فاز رویشی به زایشی یک مرحله‌ی تکاملی مهم است که تحت کنترل شبکه ژنتیکی پیچیده‌ای می‌باشد. برای به حداکثر رساندن موفقیت تولید مثلی، زمان این تغییر فاز با شرایط فیزیولوژیکی و محیطی گیاه هماهنگ است [23]. علائم بیرونی مانند دما، طول روز و در دسترس بودن مواد مغذی و هم‌چنین سیگنال‌های درونی زمان گذر به گل‌دهی را تحت تاثیر قرار می‌دهند و منجر به تبدیل مریستم راسی ساقه به مریستم گل‌آذین شده و پس از آن مریستم گل شکل می‌گیرد [14]. بررسی‌های زیادی شرح مفصلی از مسیر‌های زمان گل‌دهی گزارش کردند که در نهایت همه‌ی این مسیرها هم‌سو شده و گروه کوچکی از ژن‌های موسوم به ژن‌های تعیین هویت مریستم گل را فعال می‌کنند [25 و 4]. یکی از ژن‌های تعیین هویت مریستم گل در آرابیدوپسیس APETALA1 است که نقش مهمی در تنظیم و کنترل گل‌دهی دارد[13 و 5]. ژن SQAMOSA به عنوان هم‌ساخت ژن AP1 در گل میمون شناسایی شده است [8]. تاکنون در بسیاری از گونه‌های دیگر نیز ژن‌های هم‌ساخت AP1 شناسایی شده‌اند [12و 22]. در آرابیدوپسیس ژن AP1 در تعیین هویت مریستم گل و نمو کاسبرگ و گلبرگ دخیل است [8 و 15]. در گیاهان نوع وحشی در اولین تشکیل پریموردیوم گل، RNAی AP1 به طور یکنواخت در سراسر مریستم گل تجمع می‌یابد به طوری که در مراحل بعدی رشد ونمو بیان آن در مرکز گل کاهش یافته و تنها به سلول هایی محدود می‌شود که در دو حلقه‌ی بیرونی اندام‌های گل وجود دارند [10]. این ژن در آرابیدوپسیس روی کروموزوم‌های شماره یک، دو، سه و پنج قرار دارد، دارای هشت اگزون و هفت اینترون در نواحی حفاظت شده است و یک فاکتور رونویسی مخصوص و متعلق به MADS-box را کد می‌کند [11]. AP1 عمدتا در طی شروع نمو گل بر تعدادی از ژن‌های زمان گل‌دهی اثر مهاری دارد و با کاهش فعالیت این ژن‌ها باعث کاهش هویت گل‌آذین و در نتیجه تعیین هویت مریستم گل (تشکیل گل) می‌شود [23]. جهش در این ژن باعث می‌شود در زمانی که گیاهان تیپ وحشی شروع به گل‌دهی می‌کنند، جهش یافته‌های ap1 به جای اندام‌های گل همچنان به تولید برگ ادامه دهند. یکی دیگر از نقش‌های AP1 در نمو گل تحریک رونویسی ژن‌های کلاس B و E (ژن‌های تعیین هویت اندام گل) است [14]. هم چنین یافته‌های اخیر نشان می‌دهد که AP1 در بیان ژن‌های دخیل در بسیاری از فرایندهای سلولی و رشد از جمله پاسخ‌های هورمونی [23]. با توجه به نقش و اهمیت پدیده گل‌دهی و نقش اساسی ژن AP1 در این فرایند، در مطالعه حاضر این ژن مورد بررسی و مطالعه قرار می‌گیرد.

خانواده‌ی شب بو (چلیپائیان) دارای 350 جنس و بیش از 3000 گونه است. در این خانواده جنس Brassica بزرگ‌ترین و متنوع‌ترین جنس است. این جنس تقریبا دارای 1000 گونه است که اکثر آنها پراکنش جهانی داشته و از نظر اقتصادی شامل سزیجات متعدد و گیاهان دارویی است. گیاه خردل سیاه Brassica nigraاز راسته‌ی Brassicales خانواده‌ی Brassicaceaeاست که در اغلب بخش‌های اروپا، آفریقای شمالی، هند، نواحی جنوبی سیبری، قفقاز و ایران به حالت وحشی می‌روید] 1[. این گونه، علفی، یکساله، با ارتفاع 5/1 متر یا بلندتر، تقریبا از میانه منشعب است. گل‌آذین خوشه، گل‌ها زرد رنگ و دارای 4 کاسبرگ، 4 گلبرگ با آرایش صلیبی، 6 پرچم تترادینام و تخمدان فوقانی دو برچه‌ای است. میوه خورجین و بذرها دارای 20 درصد موسیلاژ و 33-23 درصد روغن قابل استخراج هستند که به مصارف صنعتی و تهیه‌ی صابون می‌رسد] 2[. از پودر دانه‌ی خردل سیاه به عنوان ضددرد، ضد التهاب و برای درمان دردهای رماتیسمی و عصبی و رفع خفگی استفاده می‌شود [9]. هم‌چنین گزارشاتی مبنی بر موثر بودن دانه‌ی این گیاه در آسیب‌های کبدی و کلیوی نیز وجود دارد]18[.

تاکنون هیچ گزارشی در مورد توالی ژن AP1 از گیاه خردل سیاه منتشر نشده است. با توجه به نقش مهم دانه خردل سیاه که در گروه گیاهان خانواده شب‌بو قرار می‌گیرد و نیز مدل بودن اغلب گیاهان این خانواده، شناسایی، تعیین توالی و بررسی پروتئین استنباطی این ژن می‌تواند اولین قدم در راه درک ساختار، عملکرد و نقش‌ آن در گل‌دهی و سایر مراحل نموی گیاه مورد مطالعه ‌باشد.

 

مواد و روش‌ها

دانه (بذر) گیاه مورد مطالعه از شرکت پاکان بذر اصفهان خریداری و در گلدان‌های حاوی پرلیت کشت شد. گیاهان درحال رشد، به صورت یک روز در میان با 25 میلی لیتر محلول هوگلند 1/2x تغذیه شدند. پس از نمایان شدن گل‌ها، نمونه برداری از انواع بالغ انجام و برای مطالعات مولکولی، استفاده شد.

در مطالعات مولکولی، به منظور شناسایی ژن و مطالعه‌ی بیان آن، ابتدا طراحی و ساخت آغازگر‌های مناسب انجام و در واکنش‌های PCR و یا RT-PCR استفاده شدند. به این منظور، از آنجاکه توالی ژن مورد نظر نامشخص بود، آغازگرها بر اساس توالی‌های ژن موجود از سایر گیاهان هم جنس و هم خانواده، و بر اساس اصول ذکر شده طراحی گردیدند. بنابراین، توالی ژن هم‌ساخت AP1 در آرابیدوپسیس تالیانا (Accession no: AF466780.1)، آرابیدوپسیس هالری (Accession no: AB465587.1)، آرابیدوپسیس لیراتا (Accession no: AF466786.1)، خردل سفید (Accession no: X81480.1)، شاهی (Accession no: JX103194.1)، کلم
(Z37968.1:Accession no)، گل عنکبوتی (Accession no: JX103199.1) وترتیزک (Accession no: AB372085.1) از بانک ژن NCBI (http://www.ncbi.nlm.nih.gov) گرفته شد. هم‌ردیفی توالی‌ها با استفاده از نرم‌افزار ClustalW2 صورت گرفت. براساس نقاط حفاظت شده‌ی موجود، آغازگرهایی با استفاده از نرم‏افزار Gene Runner طراحی و سپس مناسب بودن آن‏ها به وسیله‌ی نرم‏افزار BLAST مورد بررسی قرار گرفت. آغازگرها به گونه‌ای طراحی شدند که بتوان در RT-PCR بیشترین طول ناحیه‌ی کدکننده‌ی ژن را به‌دست آورد و از محصول آن‌ها برای تعیین توالی استفاده کرد. ساخت آغازگرهای طراحی شده توسط شرکت پیشگام صورت گرفت. توالی آغازگرها به صورت زیر است:

Fr-BniAP1=

5′-ATG GGAAGGGGTAGGGTT-3′

Rv-BniAP1=

5′-TGGAATTGTTTCATGCGG -3′

 

برای شناسایی و جداسازی ژن هم‌ساخت AP1، از RT-PCR استفاده شد. در این روش ابتدا RNA کل، از گل بالغ استخراج شد. سپس از روی mRNAهای موجود، DNA مکمل (cDNA) ساخته شده و از آن به‌همراه آغازگر‌های Fr-AP1 و Rv-AP1 در واکنش‌ PCR برای شناسایی ژن هدف استفاده گردید.

RNA کل از گل بالغ با استفاده از محلول استخراج RNA (GeneAll, RiboEx, Total RNA isolation solution, Korea)و براساس دستورالعمل استفاده از این محلول استخراج شد. پس از اطمینان از کیفیت RNA روی ژل آگارز یک درصد برای تعیین RNAهای ریبوزومی، ساخت cDNA با استفاده از کیت ساخت cDNA شرکت فرمنتاز (RevertAid First Strand cDNA Synthesis Kit) و طبق روش ذکر شده در آن انجام و در نتیجه از روی RNA، رشته‌ی اول cDNA تهیه گردید. cDNA حاصل از گل بالغ به‌عنوان DNA الگو برای انجام RT-PCR استفاده شد. برای انجام این واکنش، مواد مورد نیاز برای PCR که از شرکت سیناکلون خریداری شده بودند (17 میکرولیتر آب دوبار تقطیر، 5/2 میکرولیتر بافر، 1 میکرولیتر dNTP،  75/0میکرولیتر MgCl2 و 25/0 میکرولیتر آنزیم Taq DNA Polymerase) به همراه 5/1 میکرولیتر cDNA و 1میکرولیتر از هریک از آغازگرهای پیش‌برنده و برگرداننده به تیوب 2/0 میلی لیتری مخصوص PCR اضافه و با پیپت کردن، به طور کامل مخلوط شد. واکنش مربوط توسط ترموسایکلر مدل  PTC(MJ Mini Personal Termal Cycler BioRad, USA 1148) و پس از بهینه‌سازی با مرحله واسرشتگی اولیه به مدت 1 دقیقه در دمای C°95آغاز گردید و با انجام 32 چرخه با دمای واسرشتگی C°94 به مدت 1 دقیقه، دمای اتصال  C°59 به مدت 1 دقیقه و دمای طویل شدن C°72 به مدت 1 دقیقه ادامه یافت و با مرحله طویل شدن به مدت 7 دقیقه در دمای C°72 به اتمام رسید. پس از انجام PCR، حضور و کیفیت محصول روی ژل آگارز 1٪ بررسی شد.

به منظور تعیین توالی قطعه‌ی تکثیر شده‌ی ژن از طریق PCR، 40 میکرولیتر از محصول PCR به همراه 20 میکرولیتر از هر یک از آغازگرهای پیش‏برنده و برگرداننده به شرکت تکاپوزیست فرستاده شد. نتایج حاصل از تعیین توالی ابتدا با نرم‌افزار‌های BLAST و ClustalW هم‌ردیف شده وسپس با توالی‌ برخی هم‌ساخت‌های AP1 موجود در بانک ژن NCBI مقایسه و میزان شباهت‌آن بررسی گردید. همچنین توالی اسید آمینه‌ی استنباطی نیز مشخص و مقایسه شد.

 

نتایج

حضور سه باند پررنگ مربوط به RNAهای ریبوزومی نشان‌ دهنده‌ی کیفیت مطلوب RNA استخراج شده برای انجام RT-PCR است (شکل1). پس از سنتز cDNA و بهینه سازی واکنش PCR ، تک باند اختصاصی مربوط به تکثیر قطعه‌ی حدود 618 نوکلئوتیدی، روی ژل آگارز مشاهده شد (شکل2). این مطلب طراحی و عملکرد صحیح آغازگرها و برنامه‌ی مناسب PCR ، به خصوص دمای اتصال مطلوب را نشان می‌دهد.

 

شکل 1: نیم‌رخ الکتروفورزیRNA کل استخراج شده از گل بالغ خردل سیاه (B. nigra). A: نشانگر مولکولی DNA 1kb (FermentaseB:RNA کل دارای سه باند واضح RNAهای ریبوزومی 28s، 18s و 5.8s است.

 

 

شکل 2. نیم ‌رخ الکتروفورزی محصول RT-PCR، نشان دهنده‌ی ‌تکثیر ناحیه‌ی مورد نظر از ژن AP1 در خردل سیاه (B. nigra). A: نشانگر مولکولی DNA 1kb (FermentaseB: باند مربوط به قطعه‌ی 618 جفت بازی سنتزشده با استفاده از آغازگرهای پیش‌ برنده‌ی FrAP1 و برگرداننده‌یRvAP1.

نتایج حاصل از توالی یابی محصول PCR، نشان دهنده‌ی توالی یابی مطلوب قطعه‌ی 618 جفت بازی مربوط به ناحیه‌ی کد کننده‌ی ژن APETALA1 بود. نتایج حاصل از BLAST نشان دهنده‌ی شباهت بسیار بالای این قطعه با سایر ژن‌های هم‌ساخت APETALA1 است. میزان شباهت این قطعه با هم‌ساخت‌های دیگر آن در خانواده‌ی شب‌بو به شرح زیر است: خردلسفید 96% (Accessin no: X81480) کتان 95%(Accession no: XM 009129455) شلغم94% (Accession no: XM010513635) شاهی92% (Accession no: KP070728). توالی خوانده شده مربوط به بخش‌هایی از اگزون 1 و طول کامل اگزون‌های 2، 3، 4، 5، 6، 7 و بخش اعظم اگزون 8 است. بنابراین این توالی مربوط به ژن هم‌ساخت APETALA1 در گیاه خردل سیاه (Brassica nigra ) است. این ژن با نام BniAP1 (Accessin no:KT156724)در بانک ژن ثبت گردید. با توجه به 618 جفت باز تعیین توالی شده، توالی پروتئین استنباطی این قطعه از ژن نشان داد که این قطعه دارای 206 اسید آمینه می‌باشد (شکل3).

 

VDLSIFSLERKLCEYSTDSCEEKILERYERYSYAERQLIAPESDANTNWSMEYNRLKAKIELLERNQRHYLGEDLQAMSSKELQNLEQQLDTALKHIRSRKNQLMYDSINELQRKEKAIQEQNSMLSKQIKEREKILRAQQEQWDQQNHGHNMPPPPPPQQHQIQHPYMLSHQTSPFLNMGGLYQEEDPMEMRRNDLDLSLNLYNC

 

شکل3. توالی پروتئین استنباطی قطعه تعیین توالی شده از ژن AP1 در خردل سیاه (B. nigra) (BniAP1)

 

بحث

گل به عنوان ساختار زایشی‌مؤثر، عامل اصلی موفقیت تکاملی گیاهان گل‌دار یا نهان‌دانگان است که بزرگ‌ترین گروه گیاهان را تشکیل می‌دهند [2]. گذر به گل‌دهی نیازمند فعال شدن مجموعه‌ای از ژن‌ها در مریستم رأسی است که بیان این ژن‌ها مریستم را از حالت رویشی به حالت گل‌آذین تبدیل می‌کند. گل‌ها ناشی از بیان ژن‌های تنظیمی به نام ژن‌های تعیین هویت مریستم گل از جمله FUL، AP1، LFY در سلول‌های مریستم رأسی هستند [8]. ژن AP1 یک پروتئین MADS-box است و باعث تحریک گل‌دهی می‌شود که این نقش را به صورت دوگانه‌ (فعال کننده و یا سرکوب کننده) انجام می‌دهد. نقش فعال کنندگی AP1 در طول نمو کاسبرگ وگلبرگ است. AP1 به پروموتور SEP3 که یکی از ژن‌های تعیین هویت اندام گل و محرک تشکیل گل‌پوش است متصل می‌شود و بیان آن به سرعت بعد از فعال شدن AP1 افزایش می‌یابد[16 و 20].AP1 عمدتا در طی شروع نمو گل به عنوان یک سرکوب‌گر نیز عمل می‌کند. شواهد موجود در باره نقش مهاری آن، دخالت چندین مکانیسم مستقل را نشان می‌دهد، یکی از آنها کمپلکس شرکت کننده در سرکوب رونویسی است که ترکیبی از پروتئین‌های SEUSS (SEU) و LEUNIG (LEU) است که به AP1 باند می‌شود. تصورمی‌شود که این مجموعه، به پروتئین‌هایی مثل هیستون دی استیلاز متصل و با ژن‌های هدف (ژن‌های مهارگر گل) واکنش، و در نتیجه ساختار کروماتین را تغییر داده و دسترسی به پروموتور این ژن‌ها کاهش می‌یابد (غیر فعال می‌شوند) [23].

در این مطالعه سعی گردید ژن AP1 در گیاه خردل سیاه که دارای خواص دارویی و صنعتی بسیاری است، شناسایی گردد.اولین مرحله در شناسایی ژن، طراحی آغازگر‌های مناسب و استفاده از آنها در واکنش‌های PCR و یا RT-PCR است. بدین سبب ابتدا بر اساس نقاط حفاظت شده موجود در ابتدا و انتهای ناحیهی کدکنندهی ژن‌ AP1 در سایر گیاهان هم خانواده، آغازگرهای مناسب طراحی و برای واکنش RT-PCR مورد استفاده قرار گرفت. طراحی آغازگرهای مناسب اصلیترین عامل تکثیر قطعه اختصاصی در واکنش PCR‌ است. برای اتصال آغازگرها به توالی مورد نظر ویژگی‌های خاصی مد نظر است. اختصاصی بودن آغازگرها برای موفقیت واکنش PCR بسیار مهم است [17]. آغازگرهای انتخابی باید روی DNA الگو توالی منحصر به فردی داشته باشند. طول آغازگر، اختصاصی بودن و نیز دما و زمان اتصال را تحت تاثیر قرار میدهد. بنابراین، این عامل در موفقیت PCR نقش به سزایی دارد [24].بهترین طول آغازگر بین 18 تا 30 نوکلئوتید است. در یک آغازگر نباید یک باز به صورت پی در پی تکرار شود. مخصوصاً از تکرار بیش از 4 باز C یا G در توالی آغازگر باید خودداری شود [3]. در ضمن طول دو آغازگر نباید بیش از 3 نوکلئوتید تفاوت داشته باشد [26]. معمولاً دمای ذوب بهینه برای آغازگرها بین °C 52 تا°C  58 است. این‌گونه آغازگرها نسبت به آغازگرهایی که دمای ذوب کمتری دارند، کارایی بهتری داشته و محصول بیشتری تولید می‌کنند. آغازگرهایی که دمای ذوب بالای °C65 دارند نیز چندان مناسب نیستند. زیرا احتمال اتصال ثانویه را افزایش ‌می‌دهند. لازم به ذکر است که تفاوت دمای ذوب دو آغازگر نباید بیش از 5 درجه باشد [26]. درصد GC یکی از مهمترین شاخص‌های DNA بوده و نشان دهنده قدرت اتصال آن است. بهتر است درصد GC در آغازگرها بین 45 تا 60 درصد باشد [7]. تک باند اختصاصی حاصل از RT-PCR روی ژل آگارز در درجه اول بیانگر طراحی و عملکرد صحیح آغازگرها و مناسب بودن غلظت مواد به کار رفته در PCR است. هم‌چنین برنامه‌ی PCR مناسب از جمله عوامل موفقیت در کسب تک باند اختصاصی است [19].

طول باند مشاهده پس از توالی یابی 618 نوکلئوتید تعیین شد. نزدیک ترین توالی نوکلئوتیدی به BniAP1 مربوط به گیاه خردل سفید (Sinapis alba) می‌باشدکه 96% با آن مشابهت دارد. پروتئین استنباطی این قطعه از ژن BniAP1 دارای 206 آمینواسید است. طول کامل پروتئین AP1 در اکثر توالی‌های پروتئینی ثبت شده از این ژن در سایت NCBI که متعلق به خانواده‌ی شب بو می‌باشند256 آمینواسید است.پروتئین AP1 به عنوان یک فاکتور رونویسی در نظر گرفته شده است زیرا محصول ژن AP1 در توالی مشابه به پروتئین‌های قلمرو (دمین) MADS است که برخی از آنها مانند SRF و MCM1 به عنوان فاکتور رونویسی نشان داده شده‌اند که بخش فعال‌کننده آنها بین سلول‌های گیاهان، پستانداران و مخمرها حفاظت شده است. ناحیه‌ی C-ترمینال AP1 شامل دمین‌های فعال کننده رونویسی است که در سلول‌های مخمر و پستانداران از طریق بخش‌های آمینواسیدی غنی از گلوتامین و اسیدی عمل می‌کند. چنین فعالیت مشابهی از باقیمانده‌های آمینواسیدی غنی از گلوتامین و اسیدی در سلول‌های گیاهی نیز توسط Schwechheimer و همکاران (1999) نشان داده شده است [6].

 

نتیجه گیری

نتایج حاصل از این تحقیق در ابتدا نشان دهنده‌ی وجود ژن هم‌ساخت AP1 در گیاه مورد مطالعه یعنی خردل سیاه می‌باشد. 618 نوکلئوتید از ناحیه‌ی کد کننده‌ی ژن هم‌ساخت AP1 توالی یابی گردید و پس از مثبت بودن نتایج BLAST این ژن به نام BniAP1نام‌گذاری گردید. مقایسه‌ی توالی پروتئین استنباطی BniAP1 با سایر هم‌ساخت‌های AP1 نشان دهنده‌ی شباهت بین 60 تا 91 در صدی این توالی با توالی‌های مشابه بود. شناسایی توالی کامل ناحیه‌ی کد کننده، بررسی الگوی بیان، مشخص کردن بر هم‌کنش آن با سایر ژن‌های تنظیم کننده، می‌تواند به تشخیص بهتر چگونگی تنظیم عملکرد و نقش آن در القای گل‌دهی کمک کند که در مطالعات بعدی انجام می‌شود.

[1]     زرگری، ع، (1370)؛ گیاهان دارویی، انتشاراتدانشگاه تهران، جلد اول. موسسه انتشارات و چاپ دانشگاه تهران.

[2]     مظفریان، و.ا. (1379)؛ رده‌بندی گیاهان، موسسه انتشارات امیر کبیر تهران، کتاب دوم. ص 151.

[3]   Abd-Elsalam KA (2003), Bioinformatic tools and guideline for PCR primer desing, African Journal of Biotechnology,.

[4]   Amasino R (2010), Seasonal and developmental timing of flowering. The Plant Journal 61(6): 1001-1013.

[5]   Benlloch R, Berbel A, Serrano-Mislata A, Madueño F (2007), Floral initiation and inflorescence architecture: a comparative view. Ann. Bot. 100(3): 659-676.

[6]   Cho S, Jang S, Chae S, Chung KM, Moon Y-H, An G, et al. (1999), Analysis of the C-terminal region of Arabidopsis thaliana APETALA1 asa transcription activation domain. Plant Mol. Biol. 40(3): 419-429.

[7]   Dieffenbach CW, Lowe, T.M. and Dveksler, G.S. (1993), General concepts for PCR primer design. PCR Methods and Applications. 3: S30-37.

[8]   8. Glover BJ (2007). Understanding flowers and flowering: an integrated approach. edn, vol. 277. Oxford University Press Oxford.

[9]   Grigo A, Lappe M (1998), Interaction of stereo vision and optic flow processing revealed by an illusory stimulus. Vision Res.

38(2): 281-290.

[10] Gustafson-Brown C, Savidge B, Yanofsky MF (1994), Regulation of the Arabidopsis floral homeotic gene APETALA1. Cell 76(1): 131-143.

[11] Lawton-Rauh AL, Buckler E, Purugganan MD (1999), Patterns of molecular evolution among paralogous floral homeotic genes. Mol. Biol. Evol. 16(8): 1037-1045.

[12] Lowman A, Purugganan M (1999), Duplication of the Brassica oleracea APETALA1floral homeotic gene and the evolution of domesticated cauliflower. J. Hered. 90(5): 514-520.

[13] Mandel MA, Gustafson-Brown C, Savidge B, Yanofsky MF (1992), Molecular characterization of the Arabidopsis floral homeotic gene APETALA1.

[14] Ó'Maoiléidigh DS, Graciet E, Wellmer F (2014), Gene networks controlling Arabidopsis thaliana flower development. New Phytol. 201(1): 16-30.

[15] Pabón‐Mora N, Sharma B, Holappa LD, Kramer EM, Litt A (2013), The Aquilegia FRUITFULL‐like genes play key roles in leaf morphogenesis and inflorescence development. The Plant Journal 74(2): 197-212.

[16] Pelaz S, Gustafson‐Brown C, Kohalmi SE, Crosby WL, Yanofsky MF (2001), APETALA1 and SEPALLATA3 interact to promote flower development. The Plant Journal 26(4): 385-394.

[17] Qu W, Shen, Z., Zhao, D., Yang, Y. and Zhang, C (2009), MFEprimer: multiple factor evaluation of the specificity of PCR primers.

[18] Rajamurugan R, Selvaganabathy N, Kumaravel S, Ramamurthy C, SujathaV, Thirunavukkarasu C (2012), Polyphenol contents and antioxidant activity of Brassica nigra (L.) Koch. leaf extract. Nat. Prod. Res. 26(23): 2208-2210.

[19] Sambrook J, Russell DW, Russell DW (2006). The condensed protocols from molecular cloning: a laboratory manual. edn. Cold Spring Harbor Laboratory Press New York.

[20] Sridhar VV, Surendrarao A, Liu Z (2006), APETALA1 and SEPALLATA3 interactwith SEUSS to mediate transcription repression during flower development. Development 133(16): 3159-3166.

[21] TichtinckyG, Vachon G, Parcy F (2012), LEAFY: a master regulator of flower development. McGraw-Hill Yearbook of Science & Technology136-138.

[22] Wang J, Zhang X, Yan G, Zhou Y, Zhang K (2013), Over-expression of the PaAP1 gene from sweet cherry (Prunus avium L.) causes early flowering in Arabidopsis thaliana. J. Plant Physiol. 170(3): 315-320.

[23] Wellmer F, Riechmann JL (2010), Gene networks controlling the initiation of flower development. Trends Genet. 26(12): 519-527.

[24] DY, Ugozzoli, L., Pal, B.K., Qian, J. and Wallace, R.B (1991), The effect of temperature and oligonucleotide primer length on the specificity and efficiency of amplification by the polymerase chain reaction, DNA and Cell Biology.  10: 233-238.

[25] L, Mathieu J, Schmid M (2009), Just say no: floralrepressors help Arabidopsis bide the time. Curr. Opin. Plant Biol. 12(5): 580-586.

[26] Yung CH, Lin, M.C. and Chuang, L.Y. (2010), Primer Design for the PCR in Methylation Studies Using PSO Lecture Notes in Engineering and Computer Science. 2180: 213-21.